PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00051216001
Common NameGSBRNA2T00051216001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 482aa    MW: 53522.7 Da    PI: 6.0258
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00051216001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.7e-164491148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT  Ed +l+d+vk++G g+W+t+ ++  + R++k+c++rw ++l
  GSBRNA2T00051216001 44 KGPWTSTEDGILIDYVKRHGEGNWNTVQKHTSLARCGKSCRLRWANHL 91
                         79******************************************9986 PP

2Myb_DNA-binding50.16.5e-1697140146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +g++++eE++l+v+ ++++G++ W+  a++++ gRt++++k++w++
  GSBRNA2T00051216001  97 KGAFSKEEEQLIVEMHARMGNK-WAQMAEHLP-GRTDNEIKNYWNT 140
                          799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.9273991IPR017930Myb domain
SMARTSM007177.6E-114393IPR001005SANT/Myb domain
SuperFamilySSF466891.05E-2843138IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-224598IPR009057Homeodomain-like
CDDcd001673.19E-94691No hitNo description
PfamPF139216.7E-1547107No hitNo description
PROSITE profilePS5129425.07992146IPR017930Myb domain
SMARTSM007172.1E-1696144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2499145IPR009057Homeodomain-like
CDDcd001676.05E-1299140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MSYTMVTDES DDAMYSSIYN ESPSAADNIG SGCTSRGKGS VLKKGPWTST EDGILIDYVK  60
RHGEGNWNTV QKHTSLARCG KSCRLRWANH LRPNLKKGAF SKEEEQLIVE MHARMGNKWA  120
QMAEHLPGRT DNEIKNYWNT RIKRRQRAGL PLYPPGTHVE DLHWSQQYHP STSNVTDRRR  180
HQDILQLGNS KANVLFDDLT FANVLFEDLN FATSLLPVAS DISDMFSCNM LGTGASSYMS  240
PILPSHSNIR QAFQSPEHFQ NAAPQKNPRS CSISDHPMYG NQHRTDVMIQ DSHHTFTDGM  300
VPTSKPLFGA VKLELPSFQY SEASGFDQWT TPSTPQSDLL DSVDTYIQSP PPLEIDEPDC  360
FSSCDTGLLD MLLHEAKIKA SAKHSFSSTT CITNGTQNVP RGGETHIVTS GAGEIKSSSL  420
IFEAFAVVKT EEMDEVWEPK RADVIRPDVL LESSWQDQQS RFGIVRDSSS LSDALSLLLG  480
G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32421455107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009121136.10.0PREDICTED: transcription factor GAMYB-like isoform X1
TrEMBLA0A078JJQ50.0A0A078JJQ5_BRANA; BnaCnng49390D protein
STRINGBra002042.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.10.0myb domain protein 65
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]